Add missing return codes for /sequence/{id} in refget-openapi.yaml.. (#330)

Add 206, 302, 303, 307 and 501 return codes for /sequence/{id}.

Author: raskoleinonen

pub/refget-openapi.yaml

@@ -98,6 +98,14 @@ paths:
                 type: string
                 example: >-
                   MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF
+        '206':
+          description: Successful retrieval of subsequence as a single string with no line breaks
+        '302':
+          description: Redirecting the client where the sequence can be retrieved
+        '303':
+          description: Redirecting the client where the sequence can be retrieved
+        '307':
+          description: Redirecting the client where the sequence can be retrieved
         '400':
           description: Invalid input; normally due to range parameter usage
         '404':
@@ -106,6 +114,8 @@ paths:
           $ref: '#/components/responses/BadFormat'
         '416':
           description: Invalid range request specified
+        '501':
+          description: The specified request is not supported by the server          
   '/sequence/{id}/metadata':
     get:
       summary: Get reference metadata from a hash